(data stored in SCRATCH zone)

EMBL: CP001069.PE195

CP001069.PE195       Location/Qualifiers
FT   CDS             complement(224712..225191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3966"
FT                   /product="Domain of unknown function DUF1854"
FT                   /note="PFAM: Domain of unknown function DUF1854; KEGG:
FT                   rme:Rmet_0706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3966"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29071"
FT                   /db_xref="InterPro:IPR015005"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM0"
FT                   /protein_id="ACD29071.1"
FT                   /translation="MTAMQTPDFALSRNGFGKLVMTLADGTVHEGVVPVRAFPISAAGE
FT                   GLSLMSTDGRELAWITQPDALPTPMRALIEAELGAREFMPEIRTIVGVSTYATPSTWTV
FT                   QTDRGQTDLVLRGEEDIRRLTGTTLLISDSHGIHYLIRDLLALDKHSRKILDRFL"
     MTAMQTPDFA LSRNGFGKLV MTLADGTVHE GVVPVRAFPI SAAGEGLSLM STDGRELAWI        60
     TQPDALPTPM RALIEAELGA REFMPEIRTI VGVSTYATPS TWTVQTDRGQ TDLVLRGEED       120
     IRRLTGTTLL ISDSHGIHYL IRDLLALDKH SRKILDRFL                              159
//

If you have problems or comments...

PBIL Back to PBIL home page