(data stored in ACNUC7421 zone)

EMBL: CP001069.PE197

CP001069.PE197       Location/Qualifiers
FT   CDS             227801..230461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3968"
FT                   /product="cyanophycin synthetase"
FT                   /note="TIGRFAM: cyanophycin synthetase; PFAM:
FT                   phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp;
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: rme:Rmet_0704
FT                   cyanophycin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3968"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29073"
FT                   /db_xref="GOA:B2UHM2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM2"
FT                   /protein_id="ACD29073.1"
FT                   /translation="MKKKDIEILDVMSLRGPNMWTYRPVLEAWVDIGELEDSPSNTIPG
FT                   FYERLSTWLPTLIEHRCSPGVRGGFLMRLKEGTWPGHILEHVTLELQNLAGMPGGFGKA
FT                   RETPVRGVYKVIVRAWHEDVTRAALFAARDLVMAAIEDRPYDVDAAVETLRDMVDEQCL
FT                   GPSTACIVEAADDRNIPSIRLSDGNLVQLGYGARQRRIWTAETDRTSAIAESISRDKDL
FT                   TKSLLQSCGVPVPEGRMVDSAEDAWDAAEDIGVPVVVKPYDGNHGRGVFTNLMTREEVE
FT                   TAYAVAIEEGNGVIVERFVSGNEHRLLVVGGRLAAAAMGETASVVGDGNSTIEELIESQ
FT                   INSDPRRGNTEEHPLNCVRLDSAARLELKRQGYADGSAVPPAGRSVLIQRNGNVAFDVT
FT                   DRVHPSVAAHASLAARVVGLDIAGVDLVAEDISRPLDEQRGAIVEVNAGPGLLMHIRPA
FT                   QGEPRPVGRAIVDHLFSDKDGTQDDGRIPIVGITGTNGKTVVAKLVAQMLQLSGKHTGL
FT                   GCSDGLYLDRRQVESGARTDRAAWDACHRILMNRAVEAAVFESDSGMILSQGLPYDRCQ
FT                   VGVVTNFGKPDHLGDFYVEDEDRMVSVLRTQIDVVLKTGVGVLNAADARLVEMAELCDG
FT                   EVIFFALSGDLEAIAAHRAAGKRAVFVRDGKVVLATGPTELALADVSAIPLTYDGRVPF
FT                   QLENVLAAVATGWALGISNDLMRAGIMTFDVGQVDVPGRFTLFQHHGATIVVDDAHNAS
FT                   ALEALAAALDNFPAQRRTLVFGAGLQRRDEDLVAQGTVIGQTFDRVLLCEDASVKRTDA
FT                   EFDRQARALLKQGLQAGGRVAEVVVEGAKRRDVVDAALSQVTAGDLLVLQCDECAIEGT
FT                   VQQVHQWMGRAESQN"
     MKKKDIEILD VMSLRGPNMW TYRPVLEAWV DIGELEDSPS NTIPGFYERL STWLPTLIEH        60
     RCSPGVRGGF LMRLKEGTWP GHILEHVTLE LQNLAGMPGG FGKARETPVR GVYKVIVRAW       120
     HEDVTRAALF AARDLVMAAI EDRPYDVDAA VETLRDMVDE QCLGPSTACI VEAADDRNIP       180
     SIRLSDGNLV QLGYGARQRR IWTAETDRTS AIAESISRDK DLTKSLLQSC GVPVPEGRMV       240
     DSAEDAWDAA EDIGVPVVVK PYDGNHGRGV FTNLMTREEV ETAYAVAIEE GNGVIVERFV       300
     SGNEHRLLVV GGRLAAAAMG ETASVVGDGN STIEELIESQ INSDPRRGNT EEHPLNCVRL       360
     DSAARLELKR QGYADGSAVP PAGRSVLIQR NGNVAFDVTD RVHPSVAAHA SLAARVVGLD       420
     IAGVDLVAED ISRPLDEQRG AIVEVNAGPG LLMHIRPAQG EPRPVGRAIV DHLFSDKDGT       480
     QDDGRIPIVG ITGTNGKTVV AKLVAQMLQL SGKHTGLGCS DGLYLDRRQV ESGARTDRAA       540
     WDACHRILMN RAVEAAVFES DSGMILSQGL PYDRCQVGVV TNFGKPDHLG DFYVEDEDRM       600
     VSVLRTQIDV VLKTGVGVLN AADARLVEMA ELCDGEVIFF ALSGDLEAIA AHRAAGKRAV       660
     FVRDGKVVLA TGPTELALAD VSAIPLTYDG RVPFQLENVL AAVATGWALG ISNDLMRAGI       720
     MTFDVGQVDV PGRFTLFQHH GATIVVDDAH NASALEALAA ALDNFPAQRR TLVFGAGLQR       780
     RDEDLVAQGT VIGQTFDRVL LCEDASVKRT DAEFDRQARA LLKQGLQAGG RVAEVVVEGA       840
     KRRDVVDAAL SQVTAGDLLV LQCDECAIEG TVQQVHQWMG RAESQN                      886
//

If you have problems or comments...

PBIL Back to PBIL home page