(data stored in ACNUC7421 zone)

EMBL: CP001069.PE2

CP001069.PE2         Location/Qualifiers
FT   CDS             1899..2207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3762"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS02222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3762"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28878"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH27"
FT                   /protein_id="ACD28878.1"
FT                   /translation="MKLPYCGGRRESCFAIRKDVKKEGVQIVRSRTPVDPAVQRILETT
FT                   RKAWQLDAESVRAARQQRAANRRKRIKALPQDSLQALAALALQAEIWAVRKTVVTVG"
     MKLPYCGGRR ESCFAIRKDV KKEGVQIVRS RTPVDPAVQR ILETTRKAWQ LDAESVRAAR        60
     QQRAANRRKR IKALPQDSLQ ALAALALQAE IWAVRKTVVT VG                          102
//

If you have problems or comments...

PBIL Back to PBIL home page