(data stored in SCRATCH zone)

EMBL: CP001069.PE20

CP001069.PE20        Location/Qualifiers
FT   CDS             complement(20561..21865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3780"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   rso:RS02237 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3780"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28896"
FT                   /db_xref="GOA:B2UH45"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH45"
FT                   /protein_id="ACD28896.1"
FT                   /translation="MTWLTRFFKLKEHQTDVRTEVLAGLTTFLTMAYIVFVNPNILADA
FT                   GMPHDAVFVATCIAAATGTIIMGMYANYPIAMAPGMGLNAYFAYAVVKGMGFTWQAALG
FT                   AVFISGCLFLLVSVFRIREMIVNGIPHSIRVAITAGIGLFLGIVSLRGAGLVVGNPATL
FT                   VSLGDVHQPSVILAVIGFFLIVALDHLRVKGAILIGILAVTAASFFFAGNTFHGVVSMP
FT                   PSLTPTLLQLDIMGALSVGILNVVLVFFLVELFDATGTLMGVANRAGLLKQGKMDRLNK
FT                   ALLADSTAIMAGSLLGTSSTTAYIESASGVQAGGRTGLTALTVAVLFLLCLFFSPLAGV
FT                   VPAYATAPALLYVSCLMLRELVDLNWEDTTEAVPAVLTALMMPFTYSIANGVAFGFITY
FT                   SGLKLFTGRAREVPIIVWIISAVFLFRFFYLSGGH"
     MTWLTRFFKL KEHQTDVRTE VLAGLTTFLT MAYIVFVNPN ILADAGMPHD AVFVATCIAA        60
     ATGTIIMGMY ANYPIAMAPG MGLNAYFAYA VVKGMGFTWQ AALGAVFISG CLFLLVSVFR       120
     IREMIVNGIP HSIRVAITAG IGLFLGIVSL RGAGLVVGNP ATLVSLGDVH QPSVILAVIG       180
     FFLIVALDHL RVKGAILIGI LAVTAASFFF AGNTFHGVVS MPPSLTPTLL QLDIMGALSV       240
     GILNVVLVFF LVELFDATGT LMGVANRAGL LKQGKMDRLN KALLADSTAI MAGSLLGTSS       300
     TTAYIESASG VQAGGRTGLT ALTVAVLFLL CLFFSPLAGV VPAYATAPAL LYVSCLMLRE       360
     LVDLNWEDTT EAVPAVLTAL MMPFTYSIAN GVAFGFITYS GLKLFTGRAR EVPIIVWIIS       420
     AVFLFRFFYL SGGH                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page