(data stored in SCRATCH zone)

EMBL: CP001069.PE200

CP001069.PE200       Location/Qualifiers
FT   CDS             234306..234818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3971"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rso:RS03701 probable acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3971"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29076"
FT                   /db_xref="GOA:B2UHM5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM5"
FT                   /protein_id="ACD29076.1"
FT                   /translation="MSVIAIRPLIDEDVAAFKALRLRAIQDAPTAIWPTHDEEAARTLD
FT                   ETRNRIRTTDHQIVLGAFAGPELVGIAGLRREALAQVAHKAVLWGVFVDPAHRRGGIAG
FT                   RLLHAAITHARAARVLQIHLCVNAENPRAQALYRNAGFETFGIERRAMRVGDRFYDEEH
FT                   MALRLDA"
     MSVIAIRPLI DEDVAAFKAL RLRAIQDAPT AIWPTHDEEA ARTLDETRNR IRTTDHQIVL        60
     GAFAGPELVG IAGLRREALA QVAHKAVLWG VFVDPAHRRG GIAGRLLHAA ITHARAARVL       120
     QIHLCVNAEN PRAQALYRNA GFETFGIERR AMRVGDRFYD EEHMALRLDA                  170
//

If you have problems or comments...

PBIL Back to PBIL home page