(data stored in ACNUC7421 zone)

EMBL: CP001069.PE201

CP001069.PE201       Location/Qualifiers
FT   CDS             complement(234815..235831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3972"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: rso:RS05569 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3972"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29077"
FT                   /db_xref="GOA:B2UHM6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM6"
FT                   /protein_id="ACD29077.1"
FT                   /translation="MPMKNNEKGTVSVSLVNEAVTRARAHGVDMQPIMAAAGITPQMLA
FT                   QPRSRVSSAQYGALWAGIAQAMDDEFFGQDAHPMRWGSFVTMTQAALTARTGRQALARA
FT                   TGFLRLVLDDLHVRVEEDDQRVRLVFVHRKGTRVPPMFTYATWLIMVYGLVCWLVGRRI
FT                   PFIAARFRCAAPQDAQEYRLMFCDDMAFKHDASYVDLSPTFLDLPVIQTAASIKTFLRD
FT                   APGSFIVKYRNPDSFAARVRKTLRNLPVASWPASDAMALKLNVAEATMRRRLKLEGHTY
FT                   QSIKDDLRRDIAIGQLQDTRRTIADIAVAVGFAEPSAFHRAFRKWTGMRPTDYRTER"
     MPMKNNEKGT VSVSLVNEAV TRARAHGVDM QPIMAAAGIT PQMLAQPRSR VSSAQYGALW        60
     AGIAQAMDDE FFGQDAHPMR WGSFVTMTQA ALTARTGRQA LARATGFLRL VLDDLHVRVE       120
     EDDQRVRLVF VHRKGTRVPP MFTYATWLIM VYGLVCWLVG RRIPFIAARF RCAAPQDAQE       180
     YRLMFCDDMA FKHDASYVDL SPTFLDLPVI QTAASIKTFL RDAPGSFIVK YRNPDSFAAR       240
     VRKTLRNLPV ASWPASDAMA LKLNVAEATM RRRLKLEGHT YQSIKDDLRR DIAIGQLQDT       300
     RRTIADIAVA VGFAEPSAFH RAFRKWTGMR PTDYRTER                               338
//

If you have problems or comments...

PBIL Back to PBIL home page