(data stored in ACNUC7421 zone)

EMBL: CP001069.PE202

CP001069.PE202       Location/Qualifiers
FT   CDS             235997..237130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3973"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: rso:RS05570
FT                   probable acyl-CoA dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3973"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29078"
FT                   /db_xref="GOA:B2UHM7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM7"
FT                   /protein_id="ACD29078.1"
FT                   /translation="MDDFYTEEQRMIHDAARAFATERLAPNAAQWDRDGALPDEVVREM
FT                   GELGLLGMIVPAEWGGSYTDYVAYALALEEVAAGCAASATMMSVHNSVGCGPILKFGTE
FT                   AQKARYLPDLATGRAIGAFCLTEPHAGSEANNLRTRAVLRDGKWVLTGNKQFVTNGARA
FT                   DIAIVFAVTDPEAGKRGISAFIVPTDTPGFHVGRPEHKLGIRASDTCPITLEDCAVPEE
FT                   NLLGERGEGLKIALSNLEGGRIGIAAQAVGIARAAFDAARNYANERIQFGKALREHQTI
FT                   ANMLADMATRLNAARLLVHHAARLRSADKPCLSEASQAKLYASELAEEICSNAIQIHGG
FT                   YGYLADYAVERHYRDARITQIYEGTSEVQRMVIARHV"
     MDDFYTEEQR MIHDAARAFA TERLAPNAAQ WDRDGALPDE VVREMGELGL LGMIVPAEWG        60
     GSYTDYVAYA LALEEVAAGC AASATMMSVH NSVGCGPILK FGTEAQKARY LPDLATGRAI       120
     GAFCLTEPHA GSEANNLRTR AVLRDGKWVL TGNKQFVTNG ARADIAIVFA VTDPEAGKRG       180
     ISAFIVPTDT PGFHVGRPEH KLGIRASDTC PITLEDCAVP EENLLGERGE GLKIALSNLE       240
     GGRIGIAAQA VGIARAAFDA ARNYANERIQ FGKALREHQT IANMLADMAT RLNAARLLVH       300
     HAARLRSADK PCLSEASQAK LYASELAEEI CSNAIQIHGG YGYLADYAVE RHYRDARITQ       360
     IYEGTSEVQR MVIARHV                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page