(data stored in ACNUC7421 zone)

EMBL: CP001069.PE203

CP001069.PE203       Location/Qualifiers
FT   CDS             237192..238886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3974"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rso:RS05571 probable acetyl-coenzyme A synthetase
FT                   (acetate--CoA ligase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3974"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29079"
FT                   /db_xref="GOA:B2UHM8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM8"
FT                   /protein_id="ACD29079.1"
FT                   /translation="MNEAVSAAQGFVEARDFLLRHRTDYDRAYREFAWPKLDTFNWALD
FT                   YFDVMARGNDNPALWIVDDAQGEGLKLSFAQMSERSSCMANFLRGLGMVRGDRLLLMLP
FT                   NRVELWDVMLAAMKLGAVVLPATTQLSPDDVRDRVELGGATCVVVDAAELHKFESVDAS
FT                   VKRIAVGAQRDGWIDLAAAYDAPAEFVPDGPTKATDPLLLYFTSGTTSKPKLVEHTHQS
FT                   YPVGHLSTMYWIGLQPGDIHWNISSPGWAKHAWSCFFAPWNAQACVFVYNYARFVPKDT
FT                   LDVLVRFNVTTLCAPPTVWRMLVQEPLATYAVKLREIVGAGEPLNPEIIERVRSAWGVT
FT                   IRDGFGQTETTCQIGNTPGQPVVPGSVGRPLPGYRVELVDHDDQPASEGEIVLPLSHRP
FT                   LGLMQGYANNAKATAEAMRNGYYHTSDVAMRRDDGYFVYVGRTDDVFKSSDYRLSPFEL
FT                   ESVLIEHEAIAEAAVVPSSDPLRLSVPKAFVTVRQGYEAGPELARAVFLFSREKLAPYK
FT                   RIRRLQFSELPKTISGKIRRVELRRLELERTPQPARLPGEYWEEDFA"
     MNEAVSAAQG FVEARDFLLR HRTDYDRAYR EFAWPKLDTF NWALDYFDVM ARGNDNPALW        60
     IVDDAQGEGL KLSFAQMSER SSCMANFLRG LGMVRGDRLL LMLPNRVELW DVMLAAMKLG       120
     AVVLPATTQL SPDDVRDRVE LGGATCVVVD AAELHKFESV DASVKRIAVG AQRDGWIDLA       180
     AAYDAPAEFV PDGPTKATDP LLLYFTSGTT SKPKLVEHTH QSYPVGHLST MYWIGLQPGD       240
     IHWNISSPGW AKHAWSCFFA PWNAQACVFV YNYARFVPKD TLDVLVRFNV TTLCAPPTVW       300
     RMLVQEPLAT YAVKLREIVG AGEPLNPEII ERVRSAWGVT IRDGFGQTET TCQIGNTPGQ       360
     PVVPGSVGRP LPGYRVELVD HDDQPASEGE IVLPLSHRPL GLMQGYANNA KATAEAMRNG       420
     YYHTSDVAMR RDDGYFVYVG RTDDVFKSSD YRLSPFELES VLIEHEAIAE AAVVPSSDPL       480
     RLSVPKAFVT VRQGYEAGPE LARAVFLFSR EKLAPYKRIR RLQFSELPKT ISGKIRRVEL       540
     RRLELERTPQ PARLPGEYWE EDFA                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page