(data stored in SCRATCH zone)

EMBL: CP001069.PE207

CP001069.PE207       Location/Qualifiers
FT   CDS             242213..243364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3978"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rso:RS05575 putative enoyl-coenzyme A hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3978"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29083"
FT                   /db_xref="GOA:B2UHN2"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN2"
FT                   /protein_id="ACD29083.1"
FT                   /translation="MSAVQLETVPPQAAAAEPEVLMRVVNRLAIITLNRPSALNALSHG
FT                   MVRQLATLLEQCRHDDGIAALVLRGAGQKGFCAGGDVRALYQLAQQGRMDGDDGWLQFF
FT                   VDEYRLDYALHQFPKPIVALMDGVTMGGGMGLGQAARLRVVTERTKMAMPETRIGFLPD
FT                   VGATRFLSVMSPELELYVGLTGVTLTGADALHCHLADVCVPAEWLASFEDRLQRMPHDG
FT                   DLMQALRRVFEPPCNIVPHAPLAQATPWVQRYFDRRSSVDRIVATLRESLEREQAREPR
FT                   QWLQATLEAMTTHSPTMLHVTREALLRGRQLSLAECFQMELGIVARGIQEGDFCEGVRA
FT                   HLVDKDHRPGWAPATLPQVRPERVRHFLTSPWRAERHPLAGLC"
     MSAVQLETVP PQAAAAEPEV LMRVVNRLAI ITLNRPSALN ALSHGMVRQL ATLLEQCRHD        60
     DGIAALVLRG AGQKGFCAGG DVRALYQLAQ QGRMDGDDGW LQFFVDEYRL DYALHQFPKP       120
     IVALMDGVTM GGGMGLGQAA RLRVVTERTK MAMPETRIGF LPDVGATRFL SVMSPELELY       180
     VGLTGVTLTG ADALHCHLAD VCVPAEWLAS FEDRLQRMPH DGDLMQALRR VFEPPCNIVP       240
     HAPLAQATPW VQRYFDRRSS VDRIVATLRE SLEREQAREP RQWLQATLEA MTTHSPTMLH       300
     VTREALLRGR QLSLAECFQM ELGIVARGIQ EGDFCEGVRA HLVDKDHRPG WAPATLPQVR       360
     PERVRHFLTS PWRAERHPLA GLC                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page