(data stored in ACNUC7421 zone)

EMBL: CP001069.PE21

CP001069.PE21        Location/Qualifiers
FT   CDS             23271..24344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3781"
FT                   /product="plasmid encoded RepA protein"
FT                   /note="PFAM: plasmid encoded RepA protein; KEGG:
FT                   rso:RSp0001 probable RepA replicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3781"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28897"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH46"
FT                   /protein_id="ACD28897.1"
FT                   /translation="MVTKRLTPNGKPEDAAPGRIIVPSGGQVIAAPEKFQRLFDEAQAM
FT                   EREDAWQSGEVGFLSRASVQVTLPYRAPKGSPPVWTRSSGNISLMIQPGYFTQQRSERA
FT                   SNGRQRIVSETVSFGYPYGSYPRLMLAWIGKEIMAKKKRGEFQGTVEDRRISLGNSLSE
FT                   FMYNLGIPMATGGKRGTMTLVRQQMIRLFSATIAIVQNKSAPNQNQNQEPLSIDRIGYL
FT                   LADQLSTWWDPMQPGQGSMFESFVVLSEPFFNELVNRPVPVDMRALKALKQSPFALDVY
FT                   SWLTYRFFTIQKRTEIPWEALQMQFGTETESERKFRALFRKALKDVLVVYPDAKVDADS
FT                   SKALILQPSRTSVRKLA"
     MVTKRLTPNG KPEDAAPGRI IVPSGGQVIA APEKFQRLFD EAQAMEREDA WQSGEVGFLS        60
     RASVQVTLPY RAPKGSPPVW TRSSGNISLM IQPGYFTQQR SERASNGRQR IVSETVSFGY       120
     PYGSYPRLML AWIGKEIMAK KKRGEFQGTV EDRRISLGNS LSEFMYNLGI PMATGGKRGT       180
     MTLVRQQMIR LFSATIAIVQ NKSAPNQNQN QEPLSIDRIG YLLADQLSTW WDPMQPGQGS       240
     MFESFVVLSE PFFNELVNRP VPVDMRALKA LKQSPFALDV YSWLTYRFFT IQKRTEIPWE       300
     ALQMQFGTET ESERKFRALF RKALKDVLVV YPDAKVDADS SKALILQPSR TSVRKLA          357
//

If you have problems or comments...

PBIL Back to PBIL home page