(data stored in ACNUC7421 zone)

EMBL: CP001069.PE22

CP001069.PE22        Location/Qualifiers
FT   CDS             complement(24421..24624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3782"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: rso:RSp0002 probable cold shock-like
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3782"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28898"
FT                   /db_xref="GOA:B2UH47"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH47"
FT                   /protein_id="ACD28898.1"
FT                   /translation="MATGTVKWFNETKGFGFITPDGGGADLFAHFSEIQGSGFKTLKDG
FT                   QKVSFEVKQGPKGLQASGIRPE"
     MATGTVKWFN ETKGFGFITP DGGGADLFAH FSEIQGSGFK TLKDGQKVSF EVKQGPKGLQ        60
     ASGIRPE                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page