(data stored in ACNUC7421 zone)

EMBL: CP001069.PE223

CP001069.PE223       Location/Qualifiers
FT   CDS             264244..266010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3994"
FT                   /product="virulence factor family protein"
FT                   /note="PFAM: virulence factor family protein; KEGG:
FT                   rso:RS04798 probable AcvB-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3994"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29099"
FT                   /db_xref="GOA:B2UHP8"
FT                   /db_xref="InterPro:IPR010333"
FT                   /db_xref="InterPro:IPR011225"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP8"
FT                   /protein_id="ACD29099.1"
FT                   /translation="MSWQAPRTQEARHRGVLRKGLRLAGHVGAVGMVLAASWAIAADAP
FT                   APTSKPTPVQGAVLVPPVGMTGASGVVAVPPRGDMPPRLQMSGPAVTANKAANGGVLSL
FT                   PVVAPATPAAAPGAVEFVTHGRFRDVPVYKPKGEIRSVVLMLSGDLGWTPAASRMAESL
FT                   AQQGALVAGLSTPALFASLEADPGDCAFPDGDLENFSRFLQAYEKVPGYYPPILVGDNE
FT                   GGALAYAMIAQARPNIFAGAMSMEFCPVLELRKPLCKGEGVHFSRRMSESRTTAKRVKP
FT                   PENAGVVLLPATKLSAPWVALQSAMPTSFARRSGPLCDARATQAFIDTISGAQSVALPA
FT                   MATGANAPPVTASEPFKTAFAKLVAQRKPPPPPPPAAVSDLPIIEVPAQPGSSSELFAV
FT                   LLSGDGGWAGLDKEVAAALSKSGVPVVGIDSLRYFWTPRTPASAAADMDRLVRFYASRW
FT                   KKQKALLIGYSQGADVLPFIVNRLPAASREHVALAVMMGLGKRADFEFHMTNWVSSSAS
FT                   GLLILPEVQKLPAGLGMCIYGKEEKDTNCPGLDPKQVQLVKLPGGHHFDGDYAKLARIS
FT                   LEGARAPGNASR"
     MSWQAPRTQE ARHRGVLRKG LRLAGHVGAV GMVLAASWAI AADAPAPTSK PTPVQGAVLV        60
     PPVGMTGASG VVAVPPRGDM PPRLQMSGPA VTANKAANGG VLSLPVVAPA TPAAAPGAVE       120
     FVTHGRFRDV PVYKPKGEIR SVVLMLSGDL GWTPAASRMA ESLAQQGALV AGLSTPALFA       180
     SLEADPGDCA FPDGDLENFS RFLQAYEKVP GYYPPILVGD NEGGALAYAM IAQARPNIFA       240
     GAMSMEFCPV LELRKPLCKG EGVHFSRRMS ESRTTAKRVK PPENAGVVLL PATKLSAPWV       300
     ALQSAMPTSF ARRSGPLCDA RATQAFIDTI SGAQSVALPA MATGANAPPV TASEPFKTAF       360
     AKLVAQRKPP PPPPPAAVSD LPIIEVPAQP GSSSELFAVL LSGDGGWAGL DKEVAAALSK       420
     SGVPVVGIDS LRYFWTPRTP ASAAADMDRL VRFYASRWKK QKALLIGYSQ GADVLPFIVN       480
     RLPAASREHV ALAVMMGLGK RADFEFHMTN WVSSSASGLL ILPEVQKLPA GLGMCIYGKE       540
     EKDTNCPGLD PKQVQLVKLP GGHHFDGDYA KLARISLEGA RAPGNASR                    588
//

If you have problems or comments...

PBIL Back to PBIL home page