(data stored in ACNUC7421 zone)

EMBL: CP001069.PE225

CP001069.PE225       Location/Qualifiers
FT   CDS             complement(267871..268422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3996"
FT                   /product="putative alanine-rich signal peptide protein"
FT                   /note="KEGG: rso:RS04795 probable alanine-rich signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3996"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29101"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ0"
FT                   /protein_id="ACD29101.1"
FT                   /translation="MKLSALMFSIGALVMGSAFAQGTAAPATAPAAAPAAAPAAVHAVC
FT                   KDGTPYSGATLKGACRGHGGVDKKASAGGAPAAAPAAAPAASAPAKPAAAAPAAPAAAP
FT                   APAPAAKPAAAAPAKPAAAAAATVAPGGGPDKVWANASTKVYHCPGDRYYGKTKQGEYM
FT                   TEADAKAAGMRPSRNKACTK"
     MKLSALMFSI GALVMGSAFA QGTAAPATAP AAAPAAAPAA VHAVCKDGTP YSGATLKGAC        60
     RGHGGVDKKA SAGGAPAAAP AAAPAASAPA KPAAAAPAAP AAAPAPAPAA KPAAAAPAKP       120
     AAAAAATVAP GGGPDKVWAN ASTKVYHCPG DRYYGKTKQG EYMTEADAKA AGMRPSRNKA       180
     CTK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page