(data stored in SCRATCH zone)

EMBL: CP001069.PE227

CP001069.PE227       Location/Qualifiers
FT   CDS             269671..270432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3998"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: reh:H16_B1767 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3998"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29103"
FT                   /db_xref="GOA:B2UHQ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ2"
FT                   /protein_id="ACD29103.1"
FT                   /translation="MNRFEGKTVLVTGGNSGIGLAAAQAFAREGARVVITGRDAAALET
FT                   ARATLGTAGGNAALAIRNETGTVAAARELTRQLQEAGVRLDAVFINAGMAKFAAVPDVE
FT                   EALWDATFNANVKGAFFQMQALLPILNKGTSIVLNGSINAHIGMPNSSVYAASKAALIS
FT                   LAKTLSGELIGSGIRVNVVSPGPVTTPLYGKLGLDADTLAATAAQIQGQVPLGRFGQPE
FT                   EIASTVLHLSAPESAFIVGTEIIADGGMSQL"
     MNRFEGKTVL VTGGNSGIGL AAAQAFAREG ARVVITGRDA AALETARATL GTAGGNAALA        60
     IRNETGTVAA ARELTRQLQE AGVRLDAVFI NAGMAKFAAV PDVEEALWDA TFNANVKGAF       120
     FQMQALLPIL NKGTSIVLNG SINAHIGMPN SSVYAASKAA LISLAKTLSG ELIGSGIRVN       180
     VVSPGPVTTP LYGKLGLDAD TLAATAAQIQ GQVPLGRFGQ PEEIASTVLH LSAPESAFIV       240
     GTEIIADGGM SQL                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page