(data stored in ACNUC7421 zone)

EMBL: CP001069.PE228

CP001069.PE228       Location/Qualifiers
FT   CDS             270729..271370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3999"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: rso:RS04794
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3999"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29104"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ3"
FT                   /protein_id="ACD29104.1"
FT                   /translation="MKPTEENRLLLREGRKIVEALGKTLAPLVEVVLHDLTDPDHAVVA
FT                   IANNLSGRQVGDAVTELGLARLADPDFPEVIENYANRFPDGRPAKSTSIGLKNSRGDYV
FT                   AAICLNMDVSMLHAVTTGLTQLMRVDAAAPPVPESLGSRRVEDVRIALEQFAAARNTTP
FT                   MAMTLDQRREAMRELAVSGLLNLRRALTEVAQTLGVARSTVYTYLPEDLA"
     MKPTEENRLL LREGRKIVEA LGKTLAPLVE VVLHDLTDPD HAVVAIANNL SGRQVGDAVT        60
     ELGLARLADP DFPEVIENYA NRFPDGRPAK STSIGLKNSR GDYVAAICLN MDVSMLHAVT       120
     TGLTQLMRVD AAAPPVPESL GSRRVEDVRI ALEQFAAARN TTPMAMTLDQ RREAMRELAV       180
     SGLLNLRRAL TEVAQTLGVA RSTVYTYLPE DLA                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page