(data stored in ACNUC7421 zone)

EMBL: CP001069.PE232

CP001069.PE232       Location/Qualifiers
FT   CDS             complement(273768..274652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4003"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RS04791 putative transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4003"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29108"
FT                   /db_xref="GOA:B2UHQ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ7"
FT                   /protein_id="ACD29108.1"
FT                   /translation="MRHSPEALLAFAEAATLGSFSAAARKLGKRQSTISEAIANLEIDL
FT                   GLTLFDRSTRQPTLTEAGHAMLTQVRRVLDASAQMDRMAAQMAGGLEARLTLVMSDTYQ
FT                   SDRYEQTLATLEQRYPDLELECLIAEHEDVVDIIQLGRAQIGLVAAQAAYPADIGWATI
FT                   AEQSEIGLFVGLQHPLARYGDEEVPHAILREARELRLNTFVDPTGPRTDAVPVRSLRRW
FT                   SAPSYLMLLEMAVLGFGWTELPRWLVDHFAADRLHEVRARGWPRLVPVDAVWSRNRTLG
FT                   QAGAWLLETMLAG"
     MRHSPEALLA FAEAATLGSF SAAARKLGKR QSTISEAIAN LEIDLGLTLF DRSTRQPTLT        60
     EAGHAMLTQV RRVLDASAQM DRMAAQMAGG LEARLTLVMS DTYQSDRYEQ TLATLEQRYP       120
     DLELECLIAE HEDVVDIIQL GRAQIGLVAA QAAYPADIGW ATIAEQSEIG LFVGLQHPLA       180
     RYGDEEVPHA ILREARELRL NTFVDPTGPR TDAVPVRSLR RWSAPSYLML LEMAVLGFGW       240
     TELPRWLVDH FAADRLHEVR ARGWPRLVPV DAVWSRNRTL GQAGAWLLET MLAG             294
//

If you have problems or comments...

PBIL Back to PBIL home page