(data stored in SCRATCH zone)

EMBL: CP001069.PE233

CP001069.PE233       Location/Qualifiers
FT   CDS             274768..275205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4004"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   rso:RS04790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4004"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29109"
FT                   /db_xref="GOA:B2UHQ8"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ8"
FT                   /protein_id="ACD29109.1"
FT                   /translation="MQVIQKTPAERLVHALTFELVAMLICAPLFSWLMELPLAEMGVMT
FT                   LMFAAVAMVWNMVFNAIFERVERRYRLSRTLVLRVVHACLFEGGLVLMLVPLAAWWLDV
FT                   GLWEAFVLDIGIMLLFLPYTFFFNLAYDHLRARWMSRRALA"
     MQVIQKTPAE RLVHALTFEL VAMLICAPLF SWLMELPLAE MGVMTLMFAA VAMVWNMVFN        60
     AIFERVERRY RLSRTLVLRV VHACLFEGGL VLMLVPLAAW WLDVGLWEAF VLDIGIMLLF       120
     LPYTFFFNLA YDHLRARWMS RRALA                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page