(data stored in SCRATCH zone)

EMBL: CP001069.PE234

CP001069.PE234       Location/Qualifiers
FT   CDS             275320..275961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4005"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: rso:RS04789
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4005"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29110"
FT                   /db_xref="GOA:B2UHQ9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ9"
FT                   /protein_id="ACD29110.1"
FT                   /translation="MPRLSVTSPHASATVLRQCYVAACAGDAVGVMNVLRDACGADHAA
FT                   AMIRWRVDGRWHWAASRGARSADVLLHAVRGDGVDAWPMADAEVRGAVWLDYRKAGVPQ
FT                   PMQHGAAPQALLPHFAQALPLCWRRVAARAGISPAQPASLWLTDAFHLTRREADVADLL
FT                   ASGSDPACIARTLGISLDTVRTHLKHVYRKTNTHSQCDVVRLMLALSARR"
     MPRLSVTSPH ASATVLRQCY VAACAGDAVG VMNVLRDACG ADHAAAMIRW RVDGRWHWAA        60
     SRGARSADVL LHAVRGDGVD AWPMADAEVR GAVWLDYRKA GVPQPMQHGA APQALLPHFA       120
     QALPLCWRRV AARAGISPAQ PASLWLTDAF HLTRREADVA DLLASGSDPA CIARTLGISL       180
     DTVRTHLKHV YRKTNTHSQC DVVRLMLALS ARR                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page