(data stored in ACNUC7421 zone)

EMBL: CP001069.PE242

CP001069.PE242       Location/Qualifiers
FT   CDS             complement(283573..283863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4014"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29118"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR7"
FT                   /protein_id="ACD29118.1"
FT                   /translation="MTQSASTIQLDLRVLAPRERHPLIFSAFGELGIGQSLELINDHDP
FT                   RPLQSQFQVERPGQFSWDYLERGPGTWRVAITKVASAASAGHCCGGCGGGA"
     MTQSASTIQL DLRVLAPRER HPLIFSAFGE LGIGQSLELI NDHDPRPLQS QFQVERPGQF        60
     SWDYLERGPG TWRVAITKVA SAASAGHCCG GCGGGA                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page