(data stored in SCRATCH zone)

EMBL: CP001069.PE243

CP001069.PE243       Location/Qualifiers
FT   CDS             284137..285636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4015"
FT                   /product="nitrite reductase, copper-containing"
FT                   /EC_number="1.7.2.1"
FT                   /note="KEGG: rso:RS03038 probable major anaerobically
FT                   induced outer membrane transmembrane protein; TIGRFAM:
FT                   nitrite reductase, copper-containing; PFAM: blue (type 1)
FT                   copper domain protein; multicopper oxidase type 1;
FT                   cytochrome c class I; multicopper oxidase type 2;
FT                   multicopper oxidase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4015"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29119"
FT                   /db_xref="GOA:B2UHR8"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="PDB:2YQB"
FT                   /db_xref="PDB:3ZBM"
FT                   /db_xref="PDB:3ZIY"
FT                   /db_xref="PDB:4AX3"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR8"
FT                   /protein_id="ACD29119.1"
FT                   /translation="MSRLHTVRSLMRAGLISVVLGALLAGTAARAASAKLPGDFGPPRG
FT                   EPIHAVLTSPPLVPPPVHRNYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIR
FT                   VRQGDTVEFHLKNHPSSKMPHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYV
FT                   YHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDME
FT                   KAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVR
FT                   YEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGALAILKIDGPE
FT                   SKLVYSGKELDSVYLGDRAAPNMSAVTKATEASVSGTLTVQDQVQAGRALFAGTCSVCH
FT                   QGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDD
FT                   EVANILTYVLNSWDNPGGRVSAEDVKKVRAQPAPAKAVAEH"
     MSRLHTVRSL MRAGLISVVL GALLAGTAAR AASAKLPGDF GPPRGEPIHA VLTSPPLVPP        60
     PVHRNYPAKV IVELEVVEKE MQISEGVSYT FWTFGGTVPG SFIRVRQGDT VEFHLKNHPS       120
     SKMPHNIDLH GVTGPGGGAA SSFTAPGHES QFTFKALNEG IYVYHCATAP VGMHIANGMY       180
     GLILVEPPEG LPKVDHEYYV MQGDFYTAGK YREKGLQPFD MEKAIDERPS YVLFNGAEGA       240
     LTGDKALHAK VGETVRIFVG NGGPNLVSSF HVIGAIFDQV RYEGGTNVQK NVQTTLIPAG       300
     GAAVVKFTAR VPGSYVLVDH SIFRAFNKGA LAILKIDGPE SKLVYSGKEL DSVYLGDRAA       360
     PNMSAVTKAT EASVSGTLTV QDQVQAGRAL FAGTCSVCHQ GNGAGLPGVF PPLAKSDFLA       420
     ADPKRAMNIV LHGLNGKIKV NGQEYDSVMP PMTQLNDDEV ANILTYVLNS WDNPGGRVSA       480
     EDVKKVRAQP APAKAVAEH                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page