(data stored in ACNUC7421 zone)

EMBL: CP001069.PE244

CP001069.PE244       Location/Qualifiers
FT   CDS             285653..286444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4016"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   rso:RS03039 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4016"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29120"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR9"
FT                   /protein_id="ACD29120.1"
FT                   /translation="MSRLTSHIAAMLMALASATAHGATYVRLPGGDFDSVLPQNAPGQP
FT                   QRVRIEPFELRSTPVTIGEFQAFVQRHEAWQRGRVPQVFAGKAYLADWADATHADAQAS
FT                   LQAPVTGVSWFAARAYCENEGARLPTWLEWESAAAADATRTDARDDPQWAQRILGWYER
FT                   PATRVLPPVGGPADVHGVRDMHGLIWEWVDDFNALFIAGDSRTQGDPDKQKFCGAGAIS
FT                   IVRRDSYAVLMRVALLSSLEGADATGSLGFRCARSLNGDHP"
     MSRLTSHIAA MLMALASATA HGATYVRLPG GDFDSVLPQN APGQPQRVRI EPFELRSTPV        60
     TIGEFQAFVQ RHEAWQRGRV PQVFAGKAYL ADWADATHAD AQASLQAPVT GVSWFAARAY       120
     CENEGARLPT WLEWESAAAA DATRTDARDD PQWAQRILGW YERPATRVLP PVGGPADVHG       180
     VRDMHGLIWE WVDDFNALFI AGDSRTQGDP DKQKFCGAGA ISIVRRDSYA VLMRVALLSS       240
     LEGADATGSL GFRCARSLNG DHP                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page