(data stored in ACNUC7421 zone)

EMBL: CP001069.PE245

CP001069.PE245       Location/Qualifiers
FT   CDS             286441..287025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4017"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   rso:RS03040 probable signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4017"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29121"
FT                   /db_xref="GOA:B2UHS0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS0"
FT                   /protein_id="ACD29121.1"
FT                   /translation="MMFTTFIRRAFVVLLLAGATAGAHAAGPAPSASLYQSDVALTDQN
FT                   GRVFHLADLRGEPVLVSMFYASCQMVCPMIFETIRATLAKGGKPAHDGVRVLMMTVDPE
FT                   RDSVAALKKTASAHGADDRWQVARANASGTREVAALLGVQYRRLADGDFNHSSTILLLD
FT                   AEGRINARTNTLGAVDPKLVDAMRKLVAAQR"
     MMFTTFIRRA FVVLLLAGAT AGAHAAGPAP SASLYQSDVA LTDQNGRVFH LADLRGEPVL        60
     VSMFYASCQM VCPMIFETIR ATLAKGGKPA HDGVRVLMMT VDPERDSVAA LKKTASAHGA       120
     DDRWQVARAN ASGTREVAAL LGVQYRRLAD GDFNHSSTIL LLDAEGRINA RTNTLGAVDP       180
     KLVDAMRKLV AAQR                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page