(data stored in ACNUC7421 zone)

EMBL: CP001069.PE247

CP001069.PE247       Location/Qualifiers
FT   CDS             complement(287889..288656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4019"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: reh:H16_A0071 transcriptional regulator,
FT                   GntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4019"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29123"
FT                   /db_xref="GOA:B2UHS2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS2"
FT                   /protein_id="ACD29123.1"
FT                   /translation="MWCIFPILVTSVTQPLLQSPRLRTLGMSAEIASRLRTLIEEGELP
FT                   PGARIDERAFCEMFDVSKTPLREALKVLVAEGLVLHRQYIGYRVAPLDLDELRATFETL
FT                   HGLEFTAGELAAARLSEVALARLERRHQAMLDAHAAGRRTEYFRINQEIHQLIIDGTAN
FT                   PVLAGIYAALMSRVHRARGAANADMLRWQESHEEHEAIMAALREPGRPRLAQVLRHHSE
FT                   NTAKEVLSVVANSLAEASRPTRSTKESPKKGAQ"
     MWCIFPILVT SVTQPLLQSP RLRTLGMSAE IASRLRTLIE EGELPPGARI DERAFCEMFD        60
     VSKTPLREAL KVLVAEGLVL HRQYIGYRVA PLDLDELRAT FETLHGLEFT AGELAAARLS       120
     EVALARLERR HQAMLDAHAA GRRTEYFRIN QEIHQLIIDG TANPVLAGIY AALMSRVHRA       180
     RGAANADMLR WQESHEEHEA IMAALREPGR PRLAQVLRHH SENTAKEVLS VVANSLAEAS       240
     RPTRSTKESP KKGAQ                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page