(data stored in ACNUC7421 zone)

EMBL: CP001069.PE257

CP001069.PE257       Location/Qualifiers
FT   CDS             297014..298231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4030"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: rso:RS03045
FT                   probable cation-efflux system transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4030"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29133"
FT                   /db_xref="GOA:B2UHT2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT2"
FT                   /protein_id="ACD29133.1"
FT                   /translation="MHVDTPLISTIIGGIVLAFIFGTIAQRLRLPPLVGYLMAGVVAGP
FT                   FTPGFVADQSLAPQLAELGVILLMFGVGLHFSMKELLAVKAIAIPGAIGQIALATLMGM
FT                   GLAWLLGWDWGPGLVFGLALSVASTVVLLKALEDRGIDNSHEGHIAVGWLIVEDLVMVV
FT                   TLVLLPALAGALGGAGSTAVGAWDIIKVLAVTLSKVVAFAALMLVVGRRVIPWMLERIV
FT                   MTGSRELFRLGVLATALGVAYGATVLFGVSFALGAFFAGMVLAESEFSQRAAEESLPLR
FT                   DAFAVLFFVSVGMLFDPSVLIEDPWAVLGTVLIVVVGKSLAAFAVVRAFGHGNRTALTI
FT                   SASLAQIGEFSFILIGLGISLEILPDRARGLLLSAAILSILLNPLMFALINRLKREVAP
FT                   EPATAD"
     MHVDTPLIST IIGGIVLAFI FGTIAQRLRL PPLVGYLMAG VVAGPFTPGF VADQSLAPQL        60
     AELGVILLMF GVGLHFSMKE LLAVKAIAIP GAIGQIALAT LMGMGLAWLL GWDWGPGLVF       120
     GLALSVASTV VLLKALEDRG IDNSHEGHIA VGWLIVEDLV MVVTLVLLPA LAGALGGAGS       180
     TAVGAWDIIK VLAVTLSKVV AFAALMLVVG RRVIPWMLER IVMTGSRELF RLGVLATALG       240
     VAYGATVLFG VSFALGAFFA GMVLAESEFS QRAAEESLPL RDAFAVLFFV SVGMLFDPSV       300
     LIEDPWAVLG TVLIVVVGKS LAAFAVVRAF GHGNRTALTI SASLAQIGEF SFILIGLGIS       360
     LEILPDRARG LLLSAAILSI LLNPLMFALI NRLKREVAPE PATAD                       405
//

If you have problems or comments...

PBIL Back to PBIL home page