(data stored in ACNUC7421 zone)

EMBL: CP001069.PE262

CP001069.PE262       Location/Qualifiers
FT   CDS             complement(302703..303215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4035"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29138"
FT                   /db_xref="InterPro:IPR025577"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT7"
FT                   /protein_id="ACD29138.1"
FT                   /translation="MKGVLISEMAMQLSSPSVSTATAGASGSGTSSAPDIERLQRQLKN
FT                   LQKSMQDLPAQNLPPDQAREQAQLLSQQIQIVQAQIARLQAQNGLEQAETRLENRHNAS
FT                   KSASGTSTTDATTQARTTAKVTGSSTLSDARLQARHATQAQAAQAAHPASAEAITPAEP
FT                   PLVSVKA"
     MKGVLISEMA MQLSSPSVST ATAGASGSGT SSAPDIERLQ RQLKNLQKSM QDLPAQNLPP        60
     DQAREQAQLL SQQIQIVQAQ IARLQAQNGL EQAETRLENR HNASKSASGT STTDATTQAR       120
     TTAKVTGSST LSDARLQARH ATQAQAAQAA HPASAEAITP AEPPLVSVKA                  170
//

If you have problems or comments...

PBIL Back to PBIL home page