(data stored in ACNUC7421 zone)

EMBL: CP001069.PE264

CP001069.PE264       Location/Qualifiers
FT   CDS             304279..305109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4037"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_1202 ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4037"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29140"
FT                   /db_xref="GOA:B2UHT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT9"
FT                   /protein_id="ACD29140.1"
FT                   /translation="MPSSTNTMPAVGAQRTGLAHKTKIRLFQLAVVVLMFGSWEGLGRA
FT                   GVVDPFYFSMPSSIVARIWEWFTAGDIYTHLAITLAETILSFGIGTLLGISLGLWLGLS
FT                   RLAAEVLDPFIKVFNAIPRILLAPIFVMWFGLGLTSKVALGATMVLFITFFNTYQGVRE
FT                   VNPVILANARLLKASRISLLRHVYVPSATSWILSSLRASVGMAVMGAIVAEYLGSSAGL
FT                   GHLIAQAEGVFDATGVFSGIVVLSAFVIALDRSVDALEGKLLVWRPKVDPETSA"
     MPSSTNTMPA VGAQRTGLAH KTKIRLFQLA VVVLMFGSWE GLGRAGVVDP FYFSMPSSIV        60
     ARIWEWFTAG DIYTHLAITL AETILSFGIG TLLGISLGLW LGLSRLAAEV LDPFIKVFNA       120
     IPRILLAPIF VMWFGLGLTS KVALGATMVL FITFFNTYQG VREVNPVILA NARLLKASRI       180
     SLLRHVYVPS ATSWILSSLR ASVGMAVMGA IVAEYLGSSA GLGHLIAQAE GVFDATGVFS       240
     GIVVLSAFVI ALDRSVDALE GKLLVWRPKV DPETSA                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page