(data stored in ACNUC7421 zone)

EMBL: CP001069.PE265

CP001069.PE265       Location/Qualifiers
FT   CDS             305143..306147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4038"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; NMT1/THI5 like domain protein;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   mlo:mll6979 ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4038"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29141"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU0"
FT                   /protein_id="ACD29141.1"
FT                   /translation="MKRWISALLCAAVCSAANAAEPEKKDVSLSVGSMILNYMPVPLTQ
FT                   SLGNFQKEGLNVKVENFQAGGSKALQALIAGSTDAVVGFYDHTIHIQAQGKDIVSVALL
FT                   NVTPGIVLAVRPDLDIKSGKDLKGKKIGITAPGSSTDLFARYYAIKNGLQVNDVSYVAV
FT                   GSGAPGMVALDRKEIDALVNFDPVASLLEKRRAAKFLVDTRTDAGSNAVFGGRYPTATL
FT                   YVTRDFMTKNPETVQRLVNAFIRTLKWIDASTPEAIADKMPKEQQVGGRDVFVDALRHS
FT                   KPIFSKDGLMTDADAKVALTVLSSYDEKIRSARIDLAKTYTNRFVDQALKTVK"
     MKRWISALLC AAVCSAANAA EPEKKDVSLS VGSMILNYMP VPLTQSLGNF QKEGLNVKVE        60
     NFQAGGSKAL QALIAGSTDA VVGFYDHTIH IQAQGKDIVS VALLNVTPGI VLAVRPDLDI       120
     KSGKDLKGKK IGITAPGSST DLFARYYAIK NGLQVNDVSY VAVGSGAPGM VALDRKEIDA       180
     LVNFDPVASL LEKRRAAKFL VDTRTDAGSN AVFGGRYPTA TLYVTRDFMT KNPETVQRLV       240
     NAFIRTLKWI DASTPEAIAD KMPKEQQVGG RDVFVDALRH SKPIFSKDGL MTDADAKVAL       300
     TVLSSYDEKI RSARIDLAKT YTNRFVDQAL KTVK                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page