(data stored in ACNUC7421 zone)

EMBL: CP001069.PE267

CP001069.PE267       Location/Qualifiers
FT   CDS             307034..308221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4040"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reh:H16_B2210 predicted acyl-CoA
FT                   transferase/carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4040"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29143"
FT                   /db_xref="GOA:B2UHU2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU2"
FT                   /protein_id="ACD29143.1"
FT                   /translation="MALPLAGLRVLDLSNVLAGPFCGYQLGLLGAEVIKVEVPGNGDLA
FT                   RRLGADPEQARRKMGASFVAVNAGKQSVTVNLKHPEGRAILLKLVAQADALIENYRPGV
FT                   MDRLELGYDVLREVNPRLVYCAISGFGKDGPLSGRPAYDQIIQGISGVMSVTGDDASAP
FT                   LRVGYPISDTVGGITAALAVTACLLGAQRTGQGCMVDVSMLESTLATMGWVVSNYLNAG
FT                   VTPQPMGNQNFTAAPSGTFTTGDGLINIAANEDKQFAALCRVVGHPELATDARFAERHA
FT                   RKEHRQQLNDALEAALAARPATEWEPLLIDAGVPAGLVLDVPGVLAHEQVTGRGFVTAF
FT                   PEAGQHVTRAGFRLSGEDPCPQTPAPMLSAHTDDWLTRLGYRHDQIEALRAEGAI"
     MALPLAGLRV LDLSNVLAGP FCGYQLGLLG AEVIKVEVPG NGDLARRLGA DPEQARRKMG        60
     ASFVAVNAGK QSVTVNLKHP EGRAILLKLV AQADALIENY RPGVMDRLEL GYDVLREVNP       120
     RLVYCAISGF GKDGPLSGRP AYDQIIQGIS GVMSVTGDDA SAPLRVGYPI SDTVGGITAA       180
     LAVTACLLGA QRTGQGCMVD VSMLESTLAT MGWVVSNYLN AGVTPQPMGN QNFTAAPSGT       240
     FTTGDGLINI AANEDKQFAA LCRVVGHPEL ATDARFAERH ARKEHRQQLN DALEAALAAR       300
     PATEWEPLLI DAGVPAGLVL DVPGVLAHEQ VTGRGFVTAF PEAGQHVTRA GFRLSGEDPC       360
     PQTPAPMLSA HTDDWLTRLG YRHDQIEALR AEGAI                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page