(data stored in ACNUC7421 zone)

EMBL: CP001069.PE269

CP001069.PE269       Location/Qualifiers
FT   CDS             309075..309971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4042"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: pol:Bpro_4512 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4042"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29145"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU4"
FT                   /protein_id="ACD29145.1"
FT                   /translation="MTYFNWPVIETTVFAEMPVALRRPVPTEWSRANKGGAPVDCFLEG
FT                   PCWDAHGNLWLVDIPHGRILRVSSQGDWDVVAEYDGEPNGLALRHDGTLLIADYKNGLL
FT                   SLDPATGAVTPFLTRRNSERFKGPNDLIVARNGDVYFTDQGQTGLHDPTGRVYRLRTDG
FT                   RLDCLLANGPSPNGLVLTPDESALFVAMTRDNAVWRLPLLADGSTSKVGRFAQFYGTSG
FT                   PDGMAMDAAGHLFVAHASLGAVFVVSPHGEPLARIASCRGRTTTNVALTPDGHSLVITE
FT                   SATGTILRARWTPPPHD"
     MTYFNWPVIE TTVFAEMPVA LRRPVPTEWS RANKGGAPVD CFLEGPCWDA HGNLWLVDIP        60
     HGRILRVSSQ GDWDVVAEYD GEPNGLALRH DGTLLIADYK NGLLSLDPAT GAVTPFLTRR       120
     NSERFKGPND LIVARNGDVY FTDQGQTGLH DPTGRVYRLR TDGRLDCLLA NGPSPNGLVL       180
     TPDESALFVA MTRDNAVWRL PLLADGSTSK VGRFAQFYGT SGPDGMAMDA AGHLFVAHAS       240
     LGAVFVVSPH GEPLARIASC RGRTTTNVAL TPDGHSLVIT ESATGTILRA RWTPPPHD         298
//

If you have problems or comments...

PBIL Back to PBIL home page