(data stored in ACNUC7421 zone)

EMBL: CP001069.PE275

CP001069.PE275       Location/Qualifiers
FT   CDS             314794..316968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4048"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: CheW domain protein; ATP-binding region ATPase
FT                   domain protein; Signal transducing histidine kinase
FT                   homodimeric; Hpt domain protein; CheY binding; KEGG:
FT                   rso:RSp1408 probable chemotaxis sensor histidine kinase
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4048"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29151"
FT                   /db_xref="GOA:B2UHV0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR015162"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV0"
FT                   /protein_id="ACD29151.1"
FT                   /translation="MNLDLSQFFGAFFEEAEELLVDMERLLLNLDVANPSSDDLNAIFR
FT                   CAHSIKGGAATFGFTHMTELTHVAESILDRARTGTLQLRENMVDAFLETKDVLKSQLDA
FT                   YRQEHPIDTATLEYMVAKLNSLTAEDGAPVAAAPAVAAPVAAAPEPVAAPQPAPVVVEA
FT                   PAAEVVGDIEGGLDIKLINVSNEDCELIVTELKHLGTVLRHARTGRNSDIVLQSTCTAD
FT                   DIIAVSCFIIDADQIVITPHVGGAAPAAEAAAPVVAAPTPAAAQTEVHAPAANEAAPAQ
FT                   AVAAAAVPVPVRPAAADQKPTVAAETSIRVGVEKVDQLINLVGELVITQAMLAQTAQAF
FT                   DPVLNERLFAGLSQLTRNARDLQEAAMSIRMMPMDYVFNRFPRLVRDLAHKLGKQVELS
FT                   TFGKSTELDKGLIERIIDPLTHLVRNSLDHGIELPEARVAAGKDATGQLLLSAAHQGGN
FT                   IVIEVSDDGQGLNRDKILKKARERGLPVSDNMTDDEINQLIFAPGFSTADQVTDVSGRG
FT                   VGMDVVKQNIQSMGGYVEIQSQKGKGTTIRIVLPLTLAILDGMSVKTGDEVFILPLSCV
FT                   AESLQPRPEDIKAVPGGGRLLKVRNEYLTLVPMYERFRITPSLPDPSEGIVVILDSEGK
FT                   KIALQVDELVGQQQVVVKNLETNYRRVPGISGATILGDGSVALIVDVSALMRETRSGHS
FT                   ENAMRAVTAEKHELGEPQGGRFSTEAMAAA"
     MNLDLSQFFG AFFEEAEELL VDMERLLLNL DVANPSSDDL NAIFRCAHSI KGGAATFGFT        60
     HMTELTHVAE SILDRARTGT LQLRENMVDA FLETKDVLKS QLDAYRQEHP IDTATLEYMV       120
     AKLNSLTAED GAPVAAAPAV AAPVAAAPEP VAAPQPAPVV VEAPAAEVVG DIEGGLDIKL       180
     INVSNEDCEL IVTELKHLGT VLRHARTGRN SDIVLQSTCT ADDIIAVSCF IIDADQIVIT       240
     PHVGGAAPAA EAAAPVVAAP TPAAAQTEVH APAANEAAPA QAVAAAAVPV PVRPAAADQK       300
     PTVAAETSIR VGVEKVDQLI NLVGELVITQ AMLAQTAQAF DPVLNERLFA GLSQLTRNAR       360
     DLQEAAMSIR MMPMDYVFNR FPRLVRDLAH KLGKQVELST FGKSTELDKG LIERIIDPLT       420
     HLVRNSLDHG IELPEARVAA GKDATGQLLL SAAHQGGNIV IEVSDDGQGL NRDKILKKAR       480
     ERGLPVSDNM TDDEINQLIF APGFSTADQV TDVSGRGVGM DVVKQNIQSM GGYVEIQSQK       540
     GKGTTIRIVL PLTLAILDGM SVKTGDEVFI LPLSCVAESL QPRPEDIKAV PGGGRLLKVR       600
     NEYLTLVPMY ERFRITPSLP DPSEGIVVIL DSEGKKIALQ VDELVGQQQV VVKNLETNYR       660
     RVPGISGATI LGDGSVALIV DVSALMRETR SGHSENAMRA VTAEKHELGE PQGGRFSTEA       720
     MAAA                                                                    724
//

If you have problems or comments...

PBIL Back to PBIL home page