(data stored in ACNUC7421 zone)

EMBL: CP001069.PE276

CP001069.PE276       Location/Qualifiers
FT   CDS             317049..317540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4049"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: rso:RSp1407
FT                   probable chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4049"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29152"
FT                   /db_xref="GOA:B2UHV1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV1"
FT                   /protein_id="ACD29152.1"
FT                   /translation="MEVKKHAIGDDTGGEEYLAFTLGREEYGIDILKVQEIRGYETVTR
FT                   IANAPDFIKGVINLRGIIVPIVDLRIKFQLDRVEYNQYTVVIILNLMDRVVGIVVDGVS
FT                   DVLTLQSQQIKPAPEFSGALDTEYIRGLGSIDERMLILVDIERLLLSADMALCDEAEAA
FT                   "
     MEVKKHAIGD DTGGEEYLAF TLGREEYGID ILKVQEIRGY ETVTRIANAP DFIKGVINLR        60
     GIIVPIVDLR IKFQLDRVEY NQYTVVIILN LMDRVVGIVV DGVSDVLTLQ SQQIKPAPEF       120
     SGALDTEYIR GLGSIDERML ILVDIERLLL SADMALCDEA EAA                         163
//

If you have problems or comments...

PBIL Back to PBIL home page