(data stored in ACNUC7421 zone)

EMBL: CP001069.PE278

CP001069.PE278       Location/Qualifiers
FT   CDS             319736..321640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4051"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: reu:Reut_B5602
FT                   histidine kinase, HAMP region:bacterial chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4051"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29154"
FT                   /db_xref="GOA:B2UHV3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV3"
FT                   /protein_id="ACD29154.1"
FT                   /translation="MGWIKRLPVSTVLTGGFLIVAAMGAAIGGLGIYTITQLTKASEEL
FT                   AQKQMRAITQMGSAANSLAHASRAQTALLIATTLTERKTLSTQIADSMQHLKDGVENVR
FT                   PLFTSDEGKKMIREVDAIYPVWGKRMTDFVALMDKQGLDPTQFDSRVTAENVGLLDDTA
FT                   AFEKTLDKMVKRVEEVSAASTVKARDDAHRSRLVMMVMACAGALLGIVLGLVIARRLSR
FT                   QLGGEPSYAAEIARRIAAGDLAVHVQTRPGDHGSMLFAMAQMQQQLTGTITNIKSSADS
FT                   IASATKQIAAGNADLSQRTEEQASSLEETASSMEELTSIVKQNADNARQASQLAGSASD
FT                   IAVKGGEVVGRVVETMAGINASSKKIADIIGVIEGIAFQTNILALNAAVEAARAGEQGR
FT                   GFAVVAGEVRSLAQRSATAAKEIKELIGDSVGRVRNGSALVAEAGTVIEEVVVAVRRVT
FT                   DIMGEISAASDEQSSGIEQVNQAVNQMDEVTQQNAALVEQAAAAALSLEEQAQLLRNAV
FT                   ATFRTDASAELAVAAPIAVAAPAVPGEARPHKTEVVPSVARALASRKAAKPAVLPEAAP
FT                   EQVAGPAAEQGEKAPHDAHAPIVPVAAAVVSAAASEAVVAPALKLTTGSADEDDWSTF"
     MGWIKRLPVS TVLTGGFLIV AAMGAAIGGL GIYTITQLTK ASEELAQKQM RAITQMGSAA        60
     NSLAHASRAQ TALLIATTLT ERKTLSTQIA DSMQHLKDGV ENVRPLFTSD EGKKMIREVD       120
     AIYPVWGKRM TDFVALMDKQ GLDPTQFDSR VTAENVGLLD DTAAFEKTLD KMVKRVEEVS       180
     AASTVKARDD AHRSRLVMMV MACAGALLGI VLGLVIARRL SRQLGGEPSY AAEIARRIAA       240
     GDLAVHVQTR PGDHGSMLFA MAQMQQQLTG TITNIKSSAD SIASATKQIA AGNADLSQRT       300
     EEQASSLEET ASSMEELTSI VKQNADNARQ ASQLAGSASD IAVKGGEVVG RVVETMAGIN       360
     ASSKKIADII GVIEGIAFQT NILALNAAVE AARAGEQGRG FAVVAGEVRS LAQRSATAAK       420
     EIKELIGDSV GRVRNGSALV AEAGTVIEEV VVAVRRVTDI MGEISAASDE QSSGIEQVNQ       480
     AVNQMDEVTQ QNAALVEQAA AAALSLEEQA QLLRNAVATF RTDASAELAV AAPIAVAAPA       540
     VPGEARPHKT EVVPSVARAL ASRKAAKPAV LPEAAPEQVA GPAAEQGEKA PHDAHAPIVP       600
     VAAAVVSAAA SEAVVAPALK LTTGSADEDD WSTF                                   634
//

If you have problems or comments...

PBIL Back to PBIL home page