(data stored in SCRATCH zone)

EMBL: CP001069.PE28

CP001069.PE28        Location/Qualifiers
FT   CDS             30651..32558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3788"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: rso:RSp0008
FT                   probable C4-dicarboxylate transport sensor kinase
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3788"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28904"
FT                   /db_xref="GOA:B2UH53"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH53"
FT                   /protein_id="ACD28904.1"
FT                   /translation="MPPSDGHADLPHPARGRGWRMAVALAMAACCAAAGWGAYAIALQR
FT                   YVAARAEEAGQRTTFYAQSLRSTLARYESLPRLAALEHVLHAALQANHPPGDAVARGAA
FT                   NAYLKEVQAATDLSAAYLLDTTGLTLAASNWDLPSSFVGQNYAFRPYFAEAMREGLGRF
FT                   YGVGNTTGETGYFLAAPVRDGSRPIGAVVVKINLDAFEATLSRSGDTVLLVDRYGVIFL
FT                   SSVPALKYRTLGTLSVDQRAALDATRQYAPHTLVPVDPRAGSVPFSADQPPQAVRVALP
FT                   GKSASVLRVQYRPVGLLGWQVAVLIDPRDEQRTALVAGASASFAMALAFAVLVALRLRT
FT                   RRREEQRRARAALREVQRDLEARIAQRTAELTSANTALASKVEALDAAQRILRETRDAA
FT                   VQAGKLAVLGQMAAGITHELNQPLTALTTLSDNANQLAERGRIDEVRGNLTHISQLANR
FT                   MGRIVSHIKAFSRKGDAARAAVSVDEAIRQALMLVETRRRQVGVTVTAPSVPADLAVWA
FT                   NAVRLEQVLVNLIRNAIDASAETPQPRSATVHVSVEPVEKWVRITVRDFGPGIPADVLP
FT                   RLFEPFFTTKVDGQGLGLGLAISLAIIEDFGGRLEGRNADDEGGGAAFIIELERAVNPA
FT                   "
     MPPSDGHADL PHPARGRGWR MAVALAMAAC CAAAGWGAYA IALQRYVAAR AEEAGQRTTF        60
     YAQSLRSTLA RYESLPRLAA LEHVLHAALQ ANHPPGDAVA RGAANAYLKE VQAATDLSAA       120
     YLLDTTGLTL AASNWDLPSS FVGQNYAFRP YFAEAMREGL GRFYGVGNTT GETGYFLAAP       180
     VRDGSRPIGA VVVKINLDAF EATLSRSGDT VLLVDRYGVI FLSSVPALKY RTLGTLSVDQ       240
     RAALDATRQY APHTLVPVDP RAGSVPFSAD QPPQAVRVAL PGKSASVLRV QYRPVGLLGW       300
     QVAVLIDPRD EQRTALVAGA SASFAMALAF AVLVALRLRT RRREEQRRAR AALREVQRDL       360
     EARIAQRTAE LTSANTALAS KVEALDAAQR ILRETRDAAV QAGKLAVLGQ MAAGITHELN       420
     QPLTALTTLS DNANQLAERG RIDEVRGNLT HISQLANRMG RIVSHIKAFS RKGDAARAAV       480
     SVDEAIRQAL MLVETRRRQV GVTVTAPSVP ADLAVWANAV RLEQVLVNLI RNAIDASAET       540
     PQPRSATVHV SVEPVEKWVR ITVRDFGPGI PADVLPRLFE PFFTTKVDGQ GLGLGLAISL       600
     AIIEDFGGRL EGRNADDEGG GAAFIIELER AVNPA                                  635
//

If you have problems or comments...

PBIL Back to PBIL home page