(data stored in ACNUC7421 zone)

EMBL: CP001069.PE29

CP001069.PE29        Location/Qualifiers
FT   CDS             32555..33913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3789"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: rso:RSp0009
FT                   probable response regulator of the C4-dicarboxylate
FT                   transport two-component regulatory system transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3789"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28905"
FT                   /db_xref="GOA:B2UH54"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH54"
FT                   /protein_id="ACD28905.1"
FT                   /translation="MTEHATPDMSSIDHAPVFLIEDDDVVRLGCEQALALADVPVQSFA
FT                   DAESALAALAAQTPAVVVTDVRLPGRDGLAVLREMLQHDRQLPVILITGHGDVTMAVAA
FT                   MRAGAYDFMEKPFHSERLVDVVRRALEKRRLTAENLRLREALQGRQAYPLIGQSAAMQN
FT                   VRRLVAALAPTDADILVTGETGSGKEVLARAIHEGSRRRGPFVALNCAALPESVFESEM
FT                   FGHEAGAFTGANRRRIGKMEYANGGTLFLDEIESMPLALQAKLLRALQERSIERLGSNA
FT                   SVPIDCRVVAAAKVDLKEASDRGAFRADLYYRLNVVSIALPPLRQRAEDIPLLMAYFLQ
FT                   QAAVRYDRPVPDWSAQDMMRWQHHDWPGNVRELKNVAERFCLGLDDGLMASEASQHSLA
FT                   GRMMAVERATIEEALRATEGNVARTADLLAVPRKTLYDKLNRHGIEPDRFRSS"
     MTEHATPDMS SIDHAPVFLI EDDDVVRLGC EQALALADVP VQSFADAESA LAALAAQTPA        60
     VVVTDVRLPG RDGLAVLREM LQHDRQLPVI LITGHGDVTM AVAAMRAGAY DFMEKPFHSE       120
     RLVDVVRRAL EKRRLTAENL RLREALQGRQ AYPLIGQSAA MQNVRRLVAA LAPTDADILV       180
     TGETGSGKEV LARAIHEGSR RRGPFVALNC AALPESVFES EMFGHEAGAF TGANRRRIGK       240
     MEYANGGTLF LDEIESMPLA LQAKLLRALQ ERSIERLGSN ASVPIDCRVV AAAKVDLKEA       300
     SDRGAFRADL YYRLNVVSIA LPPLRQRAED IPLLMAYFLQ QAAVRYDRPV PDWSAQDMMR       360
     WQHHDWPGNV RELKNVAERF CLGLDDGLMA SEASQHSLAG RMMAVERATI EEALRATEGN       420
     VARTADLLAV PRKTLYDKLN RHGIEPDRFR SS                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page