(data stored in SCRATCH zone)

EMBL: CP001069.PE292

CP001069.PE292       Location/Qualifiers
FT   CDS             335692..336294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4065"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29168"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW7"
FT                   /protein_id="ACD29168.1"
FT                   /translation="MRLRRSGLMTVALLAASLWWYGVYASRRVEPEIPTEICFVAAPTP
FT                   YDPRSGTAPDAPRAIPLNARCPVCGAFPSRAPDWAAQVIFADGDAYFFDSPLSLFIYLR
FT                   NLPRYAAGRKSADIAAAYVRAVGDGRWIAALQAVYVWGSDVPGPMRRGNLPAFRNHTDA
FT                   RDFITRHGGSVTGSAGITAERLRALEPSQPHPAGRHT"
     MRLRRSGLMT VALLAASLWW YGVYASRRVE PEIPTEICFV AAPTPYDPRS GTAPDAPRAI        60
     PLNARCPVCG AFPSRAPDWA AQVIFADGDA YFFDSPLSLF IYLRNLPRYA AGRKSADIAA       120
     AYVRAVGDGR WIAALQAVYV WGSDVPGPMR RGNLPAFRNH TDARDFITRH GGSVTGSAGI       180
     TAERLRALEP SQPHPAGRHT                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page