(data stored in SCRATCH zone)

EMBL: CP001069.PE293

CP001069.PE293       Location/Qualifiers
FT   CDS             336488..337651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4066"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: rso:RSp1394 probable
FT                   flagellar biosynthetic FlhB transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4066"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29169"
FT                   /db_xref="GOA:B2UHW8"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW8"
FT                   /protein_id="ACD29169.1"
FT                   /translation="MSEESDLEKTEPASPRRLEQAREEGDVPRSRELASFALTAVSAGG
FT                   LWVMGDSIVRAASSFLARCLEFHRYNYTSGQDQWNYVTGQFMPLAMTLGGLMLMLVIAA
FT                   LSPLALTRGAISFKPLSPDISRLFKLQGLTRMFSLEGLMELPRLLIKLFLIAGVGWLLV
FT                   RYYRGDLIELPQQDLGVAMRDTLHVAGVAFLCMAAVMMLVAAVDVPLSLWQYARKHRMT
FT                   KEEVRKEHRESEGDPHVKGRIRNLQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEK
FT                   EGGAPRVLAKGADMVAAKIRELGTEHKIPILEAPPLARALYRHTEIGHQIPEALYAAVA
FT                   EVLAYVYQLRRLHQVGGRVPVRPTDLPVPAELDPGPQPGPDDEPEDA"
     MSEESDLEKT EPASPRRLEQ AREEGDVPRS RELASFALTA VSAGGLWVMG DSIVRAASSF        60
     LARCLEFHRY NYTSGQDQWN YVTGQFMPLA MTLGGLMLML VIAALSPLAL TRGAISFKPL       120
     SPDISRLFKL QGLTRMFSLE GLMELPRLLI KLFLIAGVGW LLVRYYRGDL IELPQQDLGV       180
     AMRDTLHVAG VAFLCMAAVM MLVAAVDVPL SLWQYARKHR MTKEEVRKEH RESEGDPHVK       240
     GRIRNLQRQA AQRRMMADVP KADVIVTNPT HYAVALRYSE KEGGAPRVLA KGADMVAAKI       300
     RELGTEHKIP ILEAPPLARA LYRHTEIGHQ IPEALYAAVA EVLAYVYQLR RLHQVGGRVP       360
     VRPTDLPVPA ELDPGPQPGP DDEPEDA                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page