(data stored in SCRATCH zone)

EMBL: CP001069.PE296

CP001069.PE296       Location/Qualifiers
FT   CDS             341982..342773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4069"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29172"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX1"
FT                   /protein_id="ACD29172.1"
FT                   /translation="MTTPFAKDQAAGLRRMLGHAAARRVLVIGAEEQVDDFVDNLRIAL
FT                   SAMGRDTAVVNAQTMLAMPGVLEQYDETADVTLVAAHFGTRALSTVAEACDDVLLTFSD
FT                   GPEGLKSAYTLLKKTAVLQGSAGIRTVVCGAHSVDSAVRVFGNLANTVGQYLNTRIDFA
FT                   GYLPEDRHVELALSLGKPVASAFPASPSAMAFRQLAEEMLSWASAEAQAGDGSVPSRVV
FT                   MSARAPAQPADESAQATSMSASTATATATPGATARAAELVY"
     MTTPFAKDQA AGLRRMLGHA AARRVLVIGA EEQVDDFVDN LRIALSAMGR DTAVVNAQTM        60
     LAMPGVLEQY DETADVTLVA AHFGTRALST VAEACDDVLL TFSDGPEGLK SAYTLLKKTA       120
     VLQGSAGIRT VVCGAHSVDS AVRVFGNLAN TVGQYLNTRI DFAGYLPEDR HVELALSLGK       180
     PVASAFPASP SAMAFRQLAE EMLSWASAEA QAGDGSVPSR VVMSARAPAQ PADESAQATS       240
     MSASTATATA TPGATARAAE LVY                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page