(data stored in SCRATCH zone)

EMBL: CP001069.PE297

CP001069.PE297       Location/Qualifiers
FT   CDS             342782..343543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4070"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: rso:RSp1390 flagellar biosynthesis sigma
FT                   factor; TIGRFAM: RNA polymerase sigma factor, FliA/WhiG
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 3 domain protein; sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein; Sigma-70 region
FT                   4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4070"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29173"
FT                   /db_xref="GOA:B2UHX2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028617"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX2"
FT                   /protein_id="ACD29173.1"
FT                   /translation="MNEASKAGMDMYTATGRKTKSDEMATYAPLVRRIANQMMVKLPAS
FT                   VELDDLIQAGMMGLLDALSRYEETQGVQFEFYAAQRIRGAILDELRGSDWLPRGLRRNA
FT                   RTIEQAIQKLQQQKGRAPTETEIAVALGMSLAEYQKQLVDLQGSQLLYYEDFDREDADA
FT                   FIENRAPENDATPLDQLLDHDLRESVVAAIEGLPEREKLMMSLYYEQDLNLREIGAVMG
FT                   VSESRVCQIHSQAIARIRSRLRDRAWLPTPT"
     MNEASKAGMD MYTATGRKTK SDEMATYAPL VRRIANQMMV KLPASVELDD LIQAGMMGLL        60
     DALSRYEETQ GVQFEFYAAQ RIRGAILDEL RGSDWLPRGL RRNARTIEQA IQKLQQQKGR       120
     APTETEIAVA LGMSLAEYQK QLVDLQGSQL LYYEDFDRED ADAFIENRAP ENDATPLDQL       180
     LDHDLRESVV AAIEGLPERE KLMMSLYYEQ DLNLREIGAV MGVSESRVCQ IHSQAIARIR       240
     SRLRDRAWLP TPT                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page