(data stored in ACNUC7421 zone)

EMBL: CP001069.PE298

CP001069.PE298       Location/Qualifiers
FT   CDS             343922..345349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4071"
FT                   /product="xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; xanthine
FT                   permease; PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   rso:RSc2118 putative xanthine permease transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4071"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29174"
FT                   /db_xref="GOA:B2UHX3"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX3"
FT                   /protein_id="ACD29174.1"
FT                   /translation="MRQSPGQPTPSSSTIADTVADPVNEFLPLPRLFALGLQHLLVMYA
FT                   GAIAVPLIVGNALGLSKSDLSYLVNCDLFAAGIGTLIQSLGFLIFGIRLPVMMGVTFAA
FT                   VAPMIAIGVEPGMGLPGIFGASIVSGVFGIAVAPLMGRLLGLFPRVVTGTVIMLIGFSL
FT                   LSVGINWAAGGQQMIPQVVDGVRHMVPNPAFGDPFGLAIAALVLVTILLLTKFGNALLC
FT                   NIAVLLGIVTGTLVAAAFGKVSMADASAAPLMTLVTPFYFGMPKFELSAIISMCIVIVI
FT                   TLVESTGMFLALAHVVGKPISRNELTNGLRADGLATVVAGVFNTFPHTSFSQNIGLVSI
FT                   TGVRSRYVAAAGGVLLIVLGLFPKLSYVVASVPQYVLGGAGIVMFGMVAAAGIRMLGMV
FT                   DFQQQRHNLLIIAVSVGFGMMPTLAPAFFHHFPDWTRPITHSGIVMGTLVAVVLNAWFN
FT                   GIRGSHEVIHGEAAAAH"
     MRQSPGQPTP SSSTIADTVA DPVNEFLPLP RLFALGLQHL LVMYAGAIAV PLIVGNALGL        60
     SKSDLSYLVN CDLFAAGIGT LIQSLGFLIF GIRLPVMMGV TFAAVAPMIA IGVEPGMGLP       120
     GIFGASIVSG VFGIAVAPLM GRLLGLFPRV VTGTVIMLIG FSLLSVGINW AAGGQQMIPQ       180
     VVDGVRHMVP NPAFGDPFGL AIAALVLVTI LLLTKFGNAL LCNIAVLLGI VTGTLVAAAF       240
     GKVSMADASA APLMTLVTPF YFGMPKFELS AIISMCIVIV ITLVESTGMF LALAHVVGKP       300
     ISRNELTNGL RADGLATVVA GVFNTFPHTS FSQNIGLVSI TGVRSRYVAA AGGVLLIVLG       360
     LFPKLSYVVA SVPQYVLGGA GIVMFGMVAA AGIRMLGMVD FQQQRHNLLI IAVSVGFGMM       420
     PTLAPAFFHH FPDWTRPITH SGIVMGTLVA VVLNAWFNGI RGSHEVIHGE AAAAH            475
//

If you have problems or comments...

PBIL Back to PBIL home page