(data stored in SCRATCH zone)

EMBL: CP001069.PE300

CP001069.PE300       Location/Qualifiers
FT   CDS             complement(346457..347680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4073"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bxe:Bxe_B2623 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4073"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29176"
FT                   /db_xref="GOA:B2UHX5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX5"
FT                   /protein_id="ACD29176.1"
FT                   /translation="MHRQLPDPSQHARIHRIALLFNANKVYDREIIAGIGDYMRSTRVT
FT                   WDLFLEEDFRCRLPGIERFDGDGIIADFDDPAVAEALRDCPLPVVAVGSSYEDAAHYPA
FT                   NVPYVATDNSKLVALAYRHLIEAGLQHFALYSLPQAPENRWAQQRELAFTRLRRQDNPA
FT                   APVEQEIYRGLSTSAPTWHQAISQLIEWLRGLPRPIGIIAVTDARARHLLQACMTAGFA
FT                   VPEEIAIIGIDNDPLTRTLSRIPLSSVIQGTVEMGRTAAHLLHQMLGGARLAGRQILVP
FT                   PVGINVLASSRHQPLASPYVMRARHFIRQYACQGIKTEQVADYVGISRSSLEEHFRREL
FT                   HCTVHQEILRHKLDAAKHMLASRDVATAEVAVRCGFTSPQYMHAVFRRELDCTPREYQE
FT                   RAIAEGQS"
     MHRQLPDPSQ HARIHRIALL FNANKVYDRE IIAGIGDYMR STRVTWDLFL EEDFRCRLPG        60
     IERFDGDGII ADFDDPAVAE ALRDCPLPVV AVGSSYEDAA HYPANVPYVA TDNSKLVALA       120
     YRHLIEAGLQ HFALYSLPQA PENRWAQQRE LAFTRLRRQD NPAAPVEQEI YRGLSTSAPT       180
     WHQAISQLIE WLRGLPRPIG IIAVTDARAR HLLQACMTAG FAVPEEIAII GIDNDPLTRT       240
     LSRIPLSSVI QGTVEMGRTA AHLLHQMLGG ARLAGRQILV PPVGINVLAS SRHQPLASPY       300
     VMRARHFIRQ YACQGIKTEQ VADYVGISRS SLEEHFRREL HCTVHQEILR HKLDAAKHML       360
     ASRDVATAEV AVRCGFTSPQ YMHAVFRREL DCTPREYQER AIAEGQS                     407
//

If you have problems or comments...

PBIL Back to PBIL home page