(data stored in ACNUC7421 zone)

EMBL: CP001069.PE305

CP001069.PE305       Location/Qualifiers
FT   CDS             352629..353534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4078"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: bxe:Bxe_C1362 putative senescence marker protein-30
FT                   (SMP-30)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4078"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29181"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY0"
FT                   /protein_id="ACD29181.1"
FT                   /translation="MMAPIIPDCVWRVGATLGEGAVWHAASRCVVFVDIQGRRLYRYDP
FT                   DTDVRRSWVAPGQIGFALPSVDGSWICGVPGGLYRFSFETGTFSRVLPVETDRPGNRLN
FT                   DGYVDRTGALWFGSMDDAEREPSGQLYRVGGDGGLSVRDSGYVITNGPTASPDGRTLYH
FT                   TDTLQRVIYAFDLGDDGSLERKRIFTSIEGSGYPDGMAVDEEGCLWVALFGGGRIERFS
FT                   PDGRCIGRVDFPCSNITKLAFGGDDLQTVYATTARKGLTDEALQKEPLAGGLFAFRAPV
FT                   RGLPSTDCAVDFSAAATGQP"
     MMAPIIPDCV WRVGATLGEG AVWHAASRCV VFVDIQGRRL YRYDPDTDVR RSWVAPGQIG        60
     FALPSVDGSW ICGVPGGLYR FSFETGTFSR VLPVETDRPG NRLNDGYVDR TGALWFGSMD       120
     DAEREPSGQL YRVGGDGGLS VRDSGYVITN GPTASPDGRT LYHTDTLQRV IYAFDLGDDG       180
     SLERKRIFTS IEGSGYPDGM AVDEEGCLWV ALFGGGRIER FSPDGRCIGR VDFPCSNITK       240
     LAFGGDDLQT VYATTARKGL TDEALQKEPL AGGLFAFRAP VRGLPSTDCA VDFSAAATGQ       300
     P                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page