(data stored in ACNUC7421 zone)

EMBL: CP001069.PE306

CP001069.PE306       Location/Qualifiers
FT   CDS             complement(353525..354709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4079"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29182"
FT                   /db_xref="GOA:B2UHY1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY1"
FT                   /protein_id="ACD29182.1"
FT                   /translation="MTAIANHLPHDLEHATLVGRVWRTTEKSKGPSVVVVRNGVVFDIT
FT                   EAVPTVADLFEHPDALAVARQAQGENLGRVETLVERSLAADRAGNAPTLLAPNDLQPIK
FT                   ACGVTFAVSLIERVIEEQAGGDPAKARDVRASIAGVVGSDLSKIKPGSDAAMRLKDELQ
FT                   RRGAWSQYMEVGIGPDAEVFSKSQPMSAVGFGADVGLHPASRWNNPEPEIVLAVSSTGH
FT                   VVGAALGNDVNLRDIEGRSALLLGKCKDNNGSCAIGPFVRLFDERFTLDTIRATQVSLR
FT                   VDGADDGFVLDGVSHMSEISRDPLDLVAQTCGPHHQYPDGFMLFLGTMFSPIKDRDAPG
FT                   AGFTHHLGDRVTISAPPLGALVNTVRLSTEIAPWTFGVRALYRNLAARGLVRQG"
     MTAIANHLPH DLEHATLVGR VWRTTEKSKG PSVVVVRNGV VFDITEAVPT VADLFEHPDA        60
     LAVARQAQGE NLGRVETLVE RSLAADRAGN APTLLAPNDL QPIKACGVTF AVSLIERVIE       120
     EQAGGDPAKA RDVRASIAGV VGSDLSKIKP GSDAAMRLKD ELQRRGAWSQ YMEVGIGPDA       180
     EVFSKSQPMS AVGFGADVGL HPASRWNNPE PEIVLAVSST GHVVGAALGN DVNLRDIEGR       240
     SALLLGKCKD NNGSCAIGPF VRLFDERFTL DTIRATQVSL RVDGADDGFV LDGVSHMSEI       300
     SRDPLDLVAQ TCGPHHQYPD GFMLFLGTMF SPIKDRDAPG AGFTHHLGDR VTISAPPLGA       360
     LVNTVRLSTE IAPWTFGVRA LYRNLAARGL VRQG                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page