(data stored in ACNUC7421 zone)

EMBL: CP001069.PE308

CP001069.PE308       Location/Qualifiers
FT   CDS             355694..356710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4081"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   bch:Bcen2424_6695 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4081"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29184"
FT                   /db_xref="GOA:B2UHY3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY3"
FT                   /protein_id="ACD29184.1"
FT                   /translation="MTTGTTPPRMADVARVAGVSKMTVSRVLAGGSVSPETRARVQEAI
FT                   DALGYVATAAAGMLSSGRSEFVAALVPSLASSNFADTVRGLSDALAPHGLQLLLGDTDY
FT                   HLDQEEALVRSLLRHQPRGIALTGRHHSPGTRALLERAGIPIVEMWDLPERPIDRAVGF
FT                   SNAKASLAMLHHLHQRGYRRIGFLCGASELDRRGTDRMRGYMSGIKSLGLGEPRVIRLG
FT                   ESPITMSHGGPAMAALLDAWPDTDAVMCVSDMSAFGAIMECHRRGLSVPGDIAVGGFGN
FT                   FEVAWCCHPTITTISVDAYGIGLRTGEVLLDALGVGEATSTRKLSRIDFSVVERESA"
     MTTGTTPPRM ADVARVAGVS KMTVSRVLAG GSVSPETRAR VQEAIDALGY VATAAAGMLS        60
     SGRSEFVAAL VPSLASSNFA DTVRGLSDAL APHGLQLLLG DTDYHLDQEE ALVRSLLRHQ       120
     PRGIALTGRH HSPGTRALLE RAGIPIVEMW DLPERPIDRA VGFSNAKASL AMLHHLHQRG       180
     YRRIGFLCGA SELDRRGTDR MRGYMSGIKS LGLGEPRVIR LGESPITMSH GGPAMAALLD       240
     AWPDTDAVMC VSDMSAFGAI MECHRRGLSV PGDIAVGGFG NFEVAWCCHP TITTISVDAY       300
     GIGLRTGEVL LDALGVGEAT STRKLSRIDF SVVERESA                               338
//

If you have problems or comments...

PBIL Back to PBIL home page