(data stored in ACNUC7421 zone)

EMBL: CP001069.PE31

CP001069.PE31        Location/Qualifiers
FT   CDS             34823..35263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3791"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RS01983 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3791"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28907"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH56"
FT                   /protein_id="ACD28907.1"
FT                   /translation="MAGQTVVKRMMWRWIWVCGFSMGILGVMTSAHAARWHEYLKTTSV
FT                   SASIERGSLRSSRAGHKTFLARTVLKRGERRAHGTRYRPGTMILSRQEIDCRRQRIRLV
FT                   DYVVRGPDGATLDTDTAAGAHWMRIRPGTLAARSAAYVCARR"
     MAGQTVVKRM MWRWIWVCGF SMGILGVMTS AHAARWHEYL KTTSVSASIE RGSLRSSRAG        60
     HKTFLARTVL KRGERRAHGT RYRPGTMILS RQEIDCRRQR IRLVDYVVRG PDGATLDTDT       120
     AAGAHWMRIR PGTLAARSAA YVCARR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page