(data stored in SCRATCH zone)

EMBL: CP001069.PE312

CP001069.PE312       Location/Qualifiers
FT   CDS             360158..361153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4085"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bpt:Bpet2223
FT                   transcriptional regulator, AraC-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4085"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29188"
FT                   /db_xref="GOA:B2UHY7"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY7"
FT                   /protein_id="ACD29188.1"
FT                   /translation="MQPQQLQQPQHPQEIAVLAFNDISPFHLSVPCLVFEDRVWAGLPS
FT                   YNLRICAGEPARKGGLRTTAGFAVQTDFTLEDAARADVLVVPSWRDTEERPPAAMVNAV
FT                   RDAYERGATVVGLCLGAFVLAEAGVLDGHEATTHWSAADAFSQRYPRVKLVPDVLYLDA
FT                   ADGRLVTSAGTAAGLDCCLHLVRRWHGAEVANRMARRLVVAPHRQGGQAQYIEQPLHDA
FT                   PGGDRLSDLLNWAVANLAQPHSLDSLAERAAMSRRNFTRRFRELTGTTVSQWLLGQRLA
FT                   YAQRMLETTRQPVEAIAQLAGFGSAVSLRQHFSRTYHTSPSAYRALFAQA"
     MQPQQLQQPQ HPQEIAVLAF NDISPFHLSV PCLVFEDRVW AGLPSYNLRI CAGEPARKGG        60
     LRTTAGFAVQ TDFTLEDAAR ADVLVVPSWR DTEERPPAAM VNAVRDAYER GATVVGLCLG       120
     AFVLAEAGVL DGHEATTHWS AADAFSQRYP RVKLVPDVLY LDAADGRLVT SAGTAAGLDC       180
     CLHLVRRWHG AEVANRMARR LVVAPHRQGG QAQYIEQPLH DAPGGDRLSD LLNWAVANLA       240
     QPHSLDSLAE RAAMSRRNFT RRFRELTGTT VSQWLLGQRL AYAQRMLETT RQPVEAIAQL       300
     AGFGSAVSLR QHFSRTYHTS PSAYRALFAQ A                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page