(data stored in ACNUC7421 zone)

EMBL: CP001069.PE314

CP001069.PE314       Location/Qualifiers
FT   CDS             complement(361450..362010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4087"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT; KEGG:
FT                   rso:RS02073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4087"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29190"
FT                   /db_xref="GOA:B2UHY9"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY9"
FT                   /protein_id="ACD29190.1"
FT                   /translation="MFGDITRFLLDTIFSLFGAALLLRAWTQAVRLSPRNPLSQAIFQL
FT                   TGWLVHPLRRVIPATGYIDWSSLVAAYATALVYLFLLVASVGVSPMALVPMGFVAALFT
FT                   VLKWAFNVLVWVTIASAVLSWMGPASPMGAVLNTLVDPLLRPIRRVVPPLGGRLDLSPL
FT                   ILLVIAQVIVIALSHLSLSPLFM"
     MFGDITRFLL DTIFSLFGAA LLLRAWTQAV RLSPRNPLSQ AIFQLTGWLV HPLRRVIPAT        60
     GYIDWSSLVA AYATALVYLF LLVASVGVSP MALVPMGFVA ALFTVLKWAF NVLVWVTIAS       120
     AVLSWMGPAS PMGAVLNTLV DPLLRPIRRV VPPLGGRLDL SPLILLVIAQ VIVIALSHLS       180
     LSPLFM                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page