(data stored in ACNUC7421 zone)

EMBL: CP001069.PE318

CP001069.PE318       Location/Qualifiers
FT   CDS             complement(364165..365124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4091"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: HEAT domain containing protein; PBS lyase HEAT
FT                   domain protein repeat-containing protein; KEGG:
FT                   pen:PSEEN0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4091"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29194"
FT                   /db_xref="GOA:B2UHZ3"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ3"
FT                   /protein_id="ACD29194.1"
FT                   /translation="MTTTPLARLHDADAATRRVALLQIADEEDADSLPNVIALLEQDPA
FT                   PEVRLEAARILATWEQPDTVAALARALEDVDGAVRDAAAIGLADLKSPESASALLAYVD
FT                   HASAFVRAAALRGLRELRVPESEAPALHALQDADAAVRREAVAVLGWRKHVGALPALAE
FT                   RARHDADVDVRRAAVGALGLATDAAVLPALLAALHDTAWRVREESASTLGKLRALAPDL
FT                   HVTQALVDALADAYWQVRLQAARALGRWRAAHAVDALAALLTHPISNLRKEAALALGEI
FT                   GEASALPALRSAQTDGDPEVVKAVRIALAQIERARASA"
     MTTTPLARLH DADAATRRVA LLQIADEEDA DSLPNVIALL EQDPAPEVRL EAARILATWE        60
     QPDTVAALAR ALEDVDGAVR DAAAIGLADL KSPESASALL AYVDHASAFV RAAALRGLRE       120
     LRVPESEAPA LHALQDADAA VRREAVAVLG WRKHVGALPA LAERARHDAD VDVRRAAVGA       180
     LGLATDAAVL PALLAALHDT AWRVREESAS TLGKLRALAP DLHVTQALVD ALADAYWQVR       240
     LQAARALGRW RAAHAVDALA ALLTHPISNL RKEAALALGE IGEASALPAL RSAQTDGDPE       300
     VVKAVRIALA QIERARASA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page