(data stored in SCRATCH zone)

EMBL: CP001069.PE319

CP001069.PE319       Location/Qualifiers
FT   CDS             complement(365132..365398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4092"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bch:Bcen2424_1973 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4092"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29195"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ4"
FT                   /protein_id="ACD29195.1"
FT                   /translation="MQQTTVHFTHTPHDITSRSSAPVTIDEAKCIADKGCTVCVDVCPL
FT                   DLLAIDLTKGKAFMQFDECWYCMPCEQDCPTGAVKVDIPYLLR"
     MQQTTVHFTH TPHDITSRSS APVTIDEAKC IADKGCTVCV DVCPLDLLAI DLTKGKAFMQ        60
     FDECWYCMPC EQDCPTGAVK VDIPYLLR                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page