(data stored in ACNUC7421 zone)

EMBL: CP001069.PE320

CP001069.PE320       Location/Qualifiers
FT   CDS             complement(365401..367125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4093"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: reh:H16_B2242 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4093"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29196"
FT                   /db_xref="GOA:B2UHZ5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ5"
FT                   /protein_id="ACD29196.1"
FT                   /translation="MNTLELEYDLVVVGGGTAGPMAAIKAKERNPALRVLLIDKAHVKR
FT                   SGAISMGMDGLNNAVIPGHATPEQYTREITLANDGIVDQSGVYAYAQHSFATIEQLDRW
FT                   GVKFEKDETGDYAVKKVHHMGSYVLPMPEGHDIKKVLYRQLKRARVEITNRIVVTRVLT
FT                   DADGAACGVLGFDCRTADFLVVRAKAVVLSCGAAGRLGLPASGYLMGTYENPTNAGDGY
FT                   AMAYHAGAELSNLECFQINPLIKDYNGPACAYVTGPLGGYTANARGERFIQCDYWSGQM
FT                   MWEFYQELQGGKGPVFLKLDHLAEETIQTIETILHTNERPSRGRFHAGRGTDYRTQMVE
FT                   MHISEIGFCSGHSASGVYVNARAETTVPGLYAAGDMAAVPHNYMLGAFTYGWFAGQNAA
FT                   DYIAGRQGVARVDDAQIERERARIFAPLQRDHGLAPAQVEYKLRRMVNDYLQPPKVTRK
FT                   MEIGLRRFDEIAEDITHLHARNPHELMRAMEVSFIRDCAEMAARASLFRTESRWGLYHH
FT                   RVDYPERDDANWFCHTRLYKDAHGAMASRKQAVEPYVIPVDVLGTDSYAQMRIPKAA"
     MNTLELEYDL VVVGGGTAGP MAAIKAKERN PALRVLLIDK AHVKRSGAIS MGMDGLNNAV        60
     IPGHATPEQY TREITLANDG IVDQSGVYAY AQHSFATIEQ LDRWGVKFEK DETGDYAVKK       120
     VHHMGSYVLP MPEGHDIKKV LYRQLKRARV EITNRIVVTR VLTDADGAAC GVLGFDCRTA       180
     DFLVVRAKAV VLSCGAAGRL GLPASGYLMG TYENPTNAGD GYAMAYHAGA ELSNLECFQI       240
     NPLIKDYNGP ACAYVTGPLG GYTANARGER FIQCDYWSGQ MMWEFYQELQ GGKGPVFLKL       300
     DHLAEETIQT IETILHTNER PSRGRFHAGR GTDYRTQMVE MHISEIGFCS GHSASGVYVN       360
     ARAETTVPGL YAAGDMAAVP HNYMLGAFTY GWFAGQNAAD YIAGRQGVAR VDDAQIERER       420
     ARIFAPLQRD HGLAPAQVEY KLRRMVNDYL QPPKVTRKME IGLRRFDEIA EDITHLHARN       480
     PHELMRAMEV SFIRDCAEMA ARASLFRTES RWGLYHHRVD YPERDDANWF CHTRLYKDAH       540
     GAMASRKQAV EPYVIPVDVL GTDSYAQMRI PKAA                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page