(data stored in SCRATCH zone)

EMBL: CP001069.PE330

CP001069.PE330       Location/Qualifiers
FT   CDS             375434..376357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4103"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG:
FT                   bch:Bcen2424_4426 recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4103"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29206"
FT                   /db_xref="GOA:B2UI05"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI05"
FT                   /protein_id="ACD29206.1"
FT                   /translation="MWFKNLQLHRLPAPWAVTPDQLEKWLAPHAFQPGNSVEKQTFGWA
FT                   SPRDDGALVYSNNGQMLLVFRAEKKLLPASVINQVTKARALELEEQQGFKPGRKQLREL
FT                   KEQVTDELLPRAFSIRRDTRVWIDTANGWLVIDAASQAVADDVRGLLVKSIDQLPLTSV
FT                   HVKHSPVAAMTEWLLSGDAPGGFTVDQDAELRSTGEGGATVRYVGHALEAEDMRRHIEA
FT                   GKQCMRLAMTWDDRVSFVLTPSLLIKRVTPLDVIKEAEDPTAQNDDERFDSDVALMTGE
FT                   LARMLSDLVDSLGGDQLDAVQQAKAA"
     MWFKNLQLHR LPAPWAVTPD QLEKWLAPHA FQPGNSVEKQ TFGWASPRDD GALVYSNNGQ        60
     MLLVFRAEKK LLPASVINQV TKARALELEE QQGFKPGRKQ LRELKEQVTD ELLPRAFSIR       120
     RDTRVWIDTA NGWLVIDAAS QAVADDVRGL LVKSIDQLPL TSVHVKHSPV AAMTEWLLSG       180
     DAPGGFTVDQ DAELRSTGEG GATVRYVGHA LEAEDMRRHI EAGKQCMRLA MTWDDRVSFV       240
     LTPSLLIKRV TPLDVIKEAE DPTAQNDDER FDSDVALMTG ELARMLSDLV DSLGGDQLDA       300
     VQQAKAA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page